Structure of PDB 3a5u Chain A Binding Site BS01

Receptor Information
>3a5u Chain A (length=118) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRQSGEWKDG
EALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFTREGEKRTVVEV
EVDEIGPSLRYATAKVNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a5u Structure of the DNA binding domain of E. coli SSB bound to ssDNA
Resolution2.8 Å
Binding residue
(original residue number in PDB)		M1 T14 A15 R20 F21 F54 R56 R61 R82 R86 F88 V99
Binding residue
(residue number reindexed from 1)		M1 T14 A15 R20 F21 F54 R56 R61 R82 R86 F88 V98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3a5u, PDBe:3a5u, PDBj:3a5u
PDBsum3a5u
PubMed
UniProtQ9AFI5|SSB_MYCS2 Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]