Structure of PDB 3a4k Chain A Binding Site BS01

Receptor Information

>3a4k Chain A (length=297) Species: 71421 (Haemophilus influenzae Rd KW20) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KSALEKLLSLIENLTNQEFKQATNSLISFIYKLNRNEVIELVRSIGILPE
AIKPSSTQEKLFSKAGDIVLAKAFQLLNLNSKPLEQGNAGDVIALSKEFN
YGLVADAKSFRLSRTAKNQKDFKVKALSEWREDKDYAVLTAPFFQYPTTK
SQIFKQSLDENVLLFSWEHLAILLQLDLEETNIFSFEQLWNFPKKQSKKT
SVSDAENNFMRDFNKYFMDLFKIDKDTLNQLLQKEINFIEERSLIEKEYW
KKQINIIKNFTREEAIEALLKDINMSSKIETIDSFIKGIKSNDRLYL

Ligand information

>3a4k Chain E (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3a4k Structures of restriction endonuclease HindIII in complex with its cognate DNA and divalent cations
Resolution	2.17 Å
Binding residue (original residue number in PDB)	G89 N90 K125 W132
Binding residue (residue number reindexed from 1)	G87 N88 K123 W130

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3a4k, PDBe:3a4k, PDBj:3a4k
PDBsum	3a4k
PubMed	19966419
UniProt	P43870\|T2D3_HAEIN Type II restriction enzyme HindIII (Gene Name=hindIIIR)

[Back to BioLiP]