Structure of PDB 3a01 Chain A Binding Site BS01

Receptor Information
>3a01 Chain A (length=78) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALA
RGLKMTDAQVKTWFQNRRTKWRRQTAEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a01 Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H175 R180 T181 R189 T190 F192 Q228 N235
Binding residue
(residue number reindexed from 1)		H6 R11 T12 R20 T21 F23 Q59 N66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3a01, PDBe:3a01, PDBj:3a01
PDBsum3a01
PubMed20389279
UniProtQ9VD99

[Back to BioLiP]