Structure of PDB 2zzm Chain A Binding Site BS01

Receptor Information
>2zzm Chain A (length=333) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILK
SILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVG
DLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEH
LAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVD
MFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSD
VREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIK
LFEKKCDCEVLEKRIVKSYAPREYILALDFKIN
Ligand information
>2zzm Chain B (length=84) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcaggggucgccaagccuggccaaaggcgcugggccuaggacccaguccc
guagggguuccaggguucaaaucccugccccugc
....<<<..<<<.............>>><<<<<<.......>>>>>><<<
....>>>...<<<<<.......>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zzm Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
Resolution2.65 Å
Binding residue
(original residue number in PDB)		K9 G12 E13 R16 N23 L25 K27 K30 L38 R77 R85 G91 L92 I93 S94 L95 S96 Y97 Q107 P129 R136 E139 V140 R145 R147 K163 E164 N165 G166 Y177 R181 P267 X318 S319 Y320 A321 P322
Binding residue
(residue number reindexed from 1)		K8 G11 E12 R15 N22 L24 K26 K29 L37 R76 R84 G90 L91 I92 S93 L94 S95 Y96 Q106 P128 R135 E138 V139 R144 R146 K162 E163 N164 G165 Y176 R180 P266 X317 S318 Y319 A320 P321
Enzymatic activity
Enzyme Commision number 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0008175 tRNA methyltransferase activity
GO:0016740 transferase activity
GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity
Biological Process
GO:0002939 tRNA N1-guanine methylation
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zzm, PDBe:2zzm, PDBj:2zzm
PDBsum2zzm
PubMed19749755
UniProtQ58293|TRM5B_METJA tRNA (guanine(37)-N1)-methyltransferase Trm5b (Gene Name=trm5b)

[Back to BioLiP]