Structure of PDB 2zne Chain A Binding Site BS01

Receptor Information
>2zne Chain A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFD
RENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFG
YRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQD
GWIQVSYEQYLSMVFSIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zne Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F72 Y91 D94 W95 F122 G123 Y124 R125 Q159 T162 F165 R166 D169 Q172
Binding residue
(residue number reindexed from 1)		F49 Y68 D71 W72 F99 G100 Y101 R102 Q136 T139 F142 R143 D146 Q149
Enzymatic activity
Catalytic site (original residue number in PDB) F85 G108 I110
Catalytic site (residue number reindexed from 1) F62 G85 I87
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2zne, PDBe:2zne, PDBj:2zne
PDBsum2zne
PubMed18940611
UniProtO75340|PDCD6_HUMAN Programmed cell death protein 6 (Gene Name=PDCD6)

[Back to BioLiP]