Structure of PDB 2zn9 Chain A Binding Site BS01

Receptor Information
>2zn9 Chain A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALS
GFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDT
DQDGWIQVSYEQYLSMVFS
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain2zn9 Chain A Residue 901 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zn9 Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D36 D38 S40 V42 E47
Binding residue
(residue number reindexed from 1)		D16 D18 S20 V22 E27
Annotation score4
Enzymatic activity
Catalytic site (original residue number in PDB) F85 G108 I110
Catalytic site (residue number reindexed from 1) F65 G88 I90
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043495 protein-membrane adaptor activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0046983 protein dimerization activity
GO:0048306 calcium-dependent protein binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0001525 angiogenesis
GO:0001938 positive regulation of endothelial cell proliferation
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006915 apoptotic process
GO:0010595 positive regulation of endothelial cell migration
GO:0014029 neural crest formation
GO:0014032 neural crest cell development
GO:0030948 negative regulation of vascular endothelial growth factor receptor signaling pathway
GO:0032007 negative regulation of TOR signaling
GO:0034605 cellular response to heat
GO:0036324 vascular endothelial growth factor receptor-2 signaling pathway
GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0048208 COPII vesicle coating
GO:0051592 response to calcium ion
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0097190 apoptotic signaling pathway
GO:1902527 positive regulation of protein monoubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0012507 ER to Golgi transport vesicle membrane
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0031410 cytoplasmic vesicle
GO:0031463 Cul3-RING ubiquitin ligase complex
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zn9, PDBe:2zn9, PDBj:2zn9
PDBsum2zn9
PubMed18940611
UniProtO75340|PDCD6_HUMAN Programmed cell death protein 6 (Gene Name=PDCD6)

[Back to BioLiP]