Structure of PDB 2zmj Chain A Binding Site BS01

Receptor Information

>2zmj Chain A (length=240) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLV
SYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDM
SWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLM
AICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMI
QKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN

Ligand information

>2zmj Chain C (length=11) Species: 8364 (Xenopus tropicalis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KNHPMLMNLLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2zmj Crystal structures of rat vitamin d receptor bound to adamantyl vitamin d analogs: structural basis for vitamin d receptor antagonism and partial agonism
Resolution	2.35 Å
Binding residue (original residue number in PDB)	I238 K242 I256 L259 K260 E416 G419
Binding residue (residue number reindexed from 1)	I58 K62 I76 L79 K80 E236 G239

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2zmj, PDBe:2zmj, PDBj:2zmj
PDBsum	2zmj
PubMed	18710208
UniProt	P13053\|VDR_RAT Vitamin D3 receptor (Gene Name=Vdr)

[Back to BioLiP]