Structure of PDB 2zld Chain A Binding Site BS01

Receptor Information

>2zld Chain A (length=339) Species: 562 (Escherichia coli)

AEIYNKDGNKVDLYGKAVGLHYFSKGGENSYGGNGDMTYARLGFKGETQI
NSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRN
YGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGL
NFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQE
AQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFA
NKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATY
YFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

Ligand information

>2zld Chain C (length=7) Species: 562 (Escherichia coli)

GGGGGGG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2zld Crystal structures of the OmpF porin: function in a colicin translocon.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): Y106 D113 L115 E117
• Binding residue (residue number reindexed from 1): Y105 D112 L114 E116

Gene Ontology

Molecular Function

• GO:0001530 lipopolysaccharide binding
• GO:0005216 monoatomic ion channel activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0015288 porin activity
• GO:0042802 identical protein binding
• GO:0042912 colicin transmembrane transporter activity
• GO:0097718 disordered domain specific binding

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0015031 protein transport
• GO:0034220 monoatomic ion transmembrane transport
• GO:0043213 bacteriocin transport
• GO:0070207 protein homotrimerization

Cellular Component

• GO:0009279 cell outer membrane
• GO:0016020 membrane
• GO:0034702 monoatomic ion channel complex
• GO:0046930 pore complex

External links

• PDB: RCSB:2zld, PDBe:2zld, PDBj:2zld
• PDBsum: 2zld
• PubMed: 18636093
• UniProt: P02931|OMPF_ECOLI Outer membrane porin F (Gene Name=ompF)