Structure of PDB 2zks Chain A Binding Site BS01

Receptor Information
>2zks Chain A (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQL
RLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSR
TIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRM
CNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSF
SSRVCTDIFKPPVATAVAPYVSWIRKVTGRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zks Structural basis for proteolytic specificity of the human apoptosis-inducing granzyme M
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H41 V80 S182 S199 F200 S201 S202 R203
Binding residue
(residue number reindexed from 1)		H41 V80 S182 S199 F200 S201 S202 R203
Enzymatic activity
Catalytic site (original residue number in PDB) H41 D86 K179 G180 D181 S182 G183
Catalytic site (residue number reindexed from 1) H41 D86 K179 G180 D181 S182 G183
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0031640 killing of cells of another organism
GO:0045087 innate immune response
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zks, PDBe:2zks, PDBj:2zks
PDBsum2zks
PubMed19542453
UniProtP51124|GRAM_HUMAN Granzyme M (Gene Name=GZMM)

[Back to BioLiP]