Structure of PDB 2zi0 Chain A Binding Site BS01

Receptor Information
>2zi0 Chain A (length=60) Species: 12315 (Tomato aspermy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQ
VELSAINSDN
Ligand information
>2zi0 Chain C (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agacagcauuaugcugucuu
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zi0 Structural basis for RNA-silencing suppression by Tomato aspermy virus protein 2b
Resolution2.82 Å
Binding residue
(original residue number in PDB)		K21 Q25 R28 H29 N32 R33 R36 H38 S40 P41 S42 R46
Binding residue
(residue number reindexed from 1)		K17 Q21 R24 H25 N28 R29 R32 H34 S36 P37 S38 R42
Binding affinityPDBbind-CN: Kd=75nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2zi0, PDBe:2zi0, PDBj:2zi0
PDBsum2zi0
PubMed18600235
UniProtQ8UYT3|2B_TAV Suppressor of silencing 2b (Gene Name=ORF2b)

[Back to BioLiP]