Structure of PDB 2zan Chain A Binding Site BS01

Receptor Information

>2zan Chain A (length=312) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLF
GPPGTGKSYLAKAVATEANNSTFFSISSSSEKLVKNLFQLARENKPSIIF
IDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPW
VLDSAIRRRFEKRIYIPLPEAHARAAMFRLHLGSTQNSLTEADFQELGRK
TDGYSGADISIIVRDALMQPVRKVQSATHFKKVRGPSRADPNCIVNDLLT
PCSPGDPGAIEMTWMDVPGDKLLEPVVSMWDMLRSLSSTKPTVNEQDLLK
LKKFTEDFGQEG

Ligand information

Ligand ID

InChI

InChI=1S/Mg/q+2

InChIKey

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Name

MAGNESIUM ION

PDB chain

2zan Chain A Residue 445 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2zan Nucleotide-dependent conformational changes and assembly of the AAA ATPase SKD1/VPS4B
Resolution	3.0 Å
Binding residue (original residue number in PDB)	S181 D234
Binding residue (residue number reindexed from 1)	S58 D102
Annotation score	1

Enzymatic activity

Enzyme Commision number

3.6.4.6: vesicle-fusing ATPase.

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0044877	protein-containing complex binding

	Biological Process
GO:0001525	angiogenesis
GO:0001778	plasma membrane repair
GO:0006813	potassium ion transport
GO:0006914	autophagy
GO:0006997	nucleus organization
GO:0007032	endosome organization
GO:0007034	vacuolar transport
GO:0007080	mitotic metaphase chromosome alignment
GO:0007417	central nervous system development
GO:0010824	regulation of centrosome duplication
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle
GO:0015031	protein transport
GO:0016197	endosomal transport
GO:0030301	cholesterol transport
GO:0031468	nuclear membrane reassembly
GO:0032510	endosome to lysosome transport via multivesicular body sorting pathway
GO:0033993	response to lipid
GO:0036258	multivesicular body assembly
GO:0039702	viral budding via host ESCRT complex
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046761	viral budding from plasma membrane
GO:0051261	protein depolymerization
GO:0051301	cell division
GO:0060070	canonical Wnt signaling pathway
GO:0060856	establishment of blood-brain barrier
GO:0061738	late endosomal microautophagy
GO:0061764	late endosome to lysosome transport via multivesicular body sorting pathway
GO:0061952	midbody abscission
GO:0071985	multivesicular body sorting pathway
GO:0090148	membrane fission
GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway
GO:0097352	autophagosome maturation
GO:1901673	regulation of mitotic spindle assembly
GO:1903542	negative regulation of exosomal secretion
GO:1903543	positive regulation of exosomal secretion
GO:1903724	positive regulation of centriole elongation
GO:1904903	ESCRT III complex disassembly

	Cellular Component
GO:0000922	spindle pole
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0030496	midbody
GO:0031902	late endosome membrane
GO:0090543	Flemming body
GO:1904949	ATPase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2zan, PDBe:2zan, PDBj:2zan
PDBsum	2zan
PubMed	18796009
UniProt	P46467\|VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B (Gene Name=Vps4b)

[Back to BioLiP]