Structure of PDB 2z9o Chain A Binding Site BS01

Receptor Information

>2z9o Chain A (length=222) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SNDLTEAAYSLSRDQKRMLYLFVDQIRDGICEIHVAKYAEIFGLTSAEAS
KDIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKRAHSPSRGLYSV
HINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSG
IVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEK
KKGRQTTHIVFSFRDITSMTTG

Ligand information

>2z9o Chain C (length=33) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttagtgtgacaatctaaaaacttgtcacacttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z9o Structural basis for regulation of bifunctional roles in replication initiator protein
Resolution	3.14 Å
Binding residue (original residue number in PDB)	Y161 P195 S197 Y198 R200 D203 R206 R207
Binding residue (residue number reindexed from 1)	Y132 P166 S168 Y169 R171 D174 R177 R178

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2z9o, PDBe:2z9o, PDBj:2z9o
PDBsum	2z9o
PubMed	18000058
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]