Structure of PDB 2z8p Chain A Binding Site BS01

Receptor Information
>2z8p Chain A (length=217) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIPSTNKHLKNNFNSLHNQMRKMPVSHFKEALDVPDYSGMRQSGFFAMSQ
GFQLNNHGYDVFIHARRESPQSQGKFAGDKFHISVLRDMVPQAFQALSGL
LFSEDSPVDKWAVTDMEKVVQQARVSLGAQFTLYIKPDQENSQYSASFLH
KTRQFIECLESRLSENGVISGQCPESDVHPENWKYLSYRNELRSGRDGGE
MQRQALREEPFYRLMTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z8p Structural basis for the catalytic mechanism of phosphothreonine lyase.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		D84 V85 F86 R90 F100 K104 H106 K134 R148 T156 Y158 K160 R213 E215 R220
Binding residue
(residue number reindexed from 1)		D60 V61 F62 R66 F76 K80 H82 K110 R124 T132 Y134 K136 R189 E191 R196
Enzymatic activity
Enzyme Commision number 4.2.3.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016829 lyase activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2z8p, PDBe:2z8p, PDBj:2z8p
PDBsum2z8p
PubMed18084305
UniProtP0A2M9|SPVC_SALTY MAPK phosphothreonine lyase (Gene Name=spvC)

[Back to BioLiP]