Structure of PDB 2z8c Chain A Binding Site BS01

Receptor Information

>2z8c Chain A (length=300) Species: 9606 (Homo sapiens)

FVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVN
ESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGD
LKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDL
AARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKD
GVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

Ligand information

>2z8c Chain B (length=6) Species: 9606 (Homo sapiens)

DYMNMS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2z8c Identification of a key element for hydrogen-bonding patterns between protein kinases and their inhibitors.
• Resolution: 3.25 Å
• Binding residue (original residue number in PDB): D1132 R1136 G1169 L1170 L1171 L1219
• Binding residue (residue number reindexed from 1): D149 R153 G186 L187 L188 L236

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171 P1172
• Catalytic site (residue number reindexed from 1): D149 A151 R153 N154 D167 E176 L188 P189
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:2z8c, PDBe:2z8c, PDBj:2z8c
• PDBsum: 2z8c
• PubMed: 18767165
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)