Structure of PDB 2z70 Chain A Binding Site BS01

Receptor Information
>2z70 Chain A (length=245) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LALQAKQYGDFDRYVLALSWQTGFCQSQHDRNRNERDECRLQTETTNKAD
FLTVHGLWPGLPKSVAARGVDERRWMRFGCATRPIPNLPEARASRMCSSP
ETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVR
LNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQGN
PAYLTEIQISIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z70 Nonspecific base recognition mediated by water bridges and hydrophobic stacking in ribonuclease I from Escherichia coli
Resolution1.7 Å
Binding residue
(original residue number in PDB)		S19 F24 H55 W58 R74 M76 F78 A81 T82 R83 Y128 Q208
Binding residue
(residue number reindexed from 1)		S19 F24 H55 W58 R74 M76 F78 A81 T82 R83 Y128 Q208
Enzymatic activity
Enzyme Commision number 4.6.1.21: Enterobacter ribonuclease.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0008847 Enterobacter ribonuclease activity
GO:0016829 lyase activity
GO:0033897 ribonuclease T2 activity
Biological Process
GO:0006401 RNA catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z70, PDBe:2z70, PDBj:2z70
PDBsum2z70
PubMed18305191
UniProtP21338|RNI_ECOLI Ribonuclease I (Gene Name=rna)

[Back to BioLiP]