Structure of PDB 2z33 Chain A Binding Site BS01

Receptor Information
>2z33 Chain A (length=104) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYS
REQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRF
STRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z33 Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment.
ResolutionN/A
Binding residue
(original residue number in PDB)		P32 T33 W59 V65 E66 T69 H73 R76 R94
Binding residue
(residue number reindexed from 1)		P32 T33 W59 V65 E66 T69 H73 R76 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2z33, PDBe:2z33, PDBj:2z33
PDBsum2z33
PubMed18186481
UniProtP0AFJ5|PHOB_ECOLI Phosphate regulon transcriptional regulatory protein PhoB (Gene Name=phoB)

[Back to BioLiP]