Structure of PDB 2z31 Chain A Binding Site BS01

Receptor Information
>2z31 Chain A (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRAS
RDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKI
TFGAGTKLQVVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z31 Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
Resolution2.7 Å
Binding residue
(original residue number in PDB)		N99 Y100 G101
Binding residue
(residue number reindexed from 1)		N94 Y95 G96
Enzymatic activity
Enzyme Commision number ?
External links