Structure of PDB 2z2p Chain A Binding Site BS01

Receptor Information

>2z2p Chain A (length=293) Species: 1280 (Staphylococcus aureus)

EFKLQELNLTNQDTGPYGITVSDKGKVWITQHKANMISCINLDGKITEYE
LPNKGAKVMCLTISSDGEVWFTENAANKIGRITKKGIIKEYTLPNPDSAP
YGITEGPNGDIWFTEMNGNRIGRITDDGKIREYELPNKGSYPSFITLGSD
NALWFTENQNNAIGRITESGDITEFKIPTPASGPVGITKGNDDALWFVEI
IGNKIGRITTSGEITEFKIPTPNARPHAITAGAGIDLWFTEWGANKIGRL
TSNNIIEEYPIQIKSAEPAGICFDGETIWFAMECDKIGKLTLI

Ligand information

>2z2p Chain C (length=8) Species: 68212 (Streptomyces graminofaciens)

TTPPFMIt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2z2p Structural Basis for Streptogramin B Resistance in Staphylococcus Aureus by Virginiamycin B Lyase
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): Y18 H33 Y102 M117 S144 Q160 A182 G184 V186 H228 W243 E268 E284
• Binding residue (residue number reindexed from 1): Y17 H32 Y101 M116 S143 Q159 A181 G183 V185 H227 W242 E267 E283

Enzymatic activity

• Enzyme Commision number: 4.2.99.-

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0016829 lyase activity
• GO:0016835 carbon-oxygen lyase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0017001 antibiotic catabolic process
• GO:0046677 response to antibiotic

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space

External links

• PDB: RCSB:2z2p, PDBe:2z2p, PDBj:2z2p
• PDBsum: 2z2p
• PubMed: 17563376
• UniProt: P17978|VGB_STAAU Virginiamycin B lyase (Gene Name=vgb)