Structure of PDB 2yyr Chain A Binding Site BS01

Receptor Information
>2yyr Chain A (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASA
VWGCDTCMAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yyr Structural analysis of PHD domain of Pygopus complexed with trimethylated histone H3 peptide
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y339 V348 N349 D350 A354 I355 L356 E358 W364 Y377 L380 T381 A386
Binding residue
(residue number reindexed from 1)		Y3 V12 N13 D14 A18 I19 L20 E22 W28 Y41 L44 T45 A50
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2yyr, PDBe:2yyr, PDBj:2yyr
PDBsum2yyr
PubMed
UniProtQ9D0P5|PYGO1_MOUSE Pygopus homolog 1 (Gene Name=Pygo1)

[Back to BioLiP]