Structure of PDB 2ys5 Chain A Binding Site BS01

Receptor Information
>2ys5 Chain A (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSGSSGLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLH
RREAVRWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNL
LQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ys5 Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2
ResolutionN/A
Binding residue
(original residue number in PDB)		N25 D27 D28 L33 W57 Y59 L60 R64 Y65 G66 Y67 D68 S73 F74 R79 I86 F87 F98 Q102 M105
Binding residue
(residue number reindexed from 1)		N25 D27 D28 L33 W57 Y59 L60 R64 Y65 G66 Y67 D68 S73 F74 R79 I86 F87 F98 Q102 M105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ys5, PDBe:2ys5, PDBj:2ys5
PDBsum2ys5
PubMed20454865
UniProtO43559|FRS3_HUMAN Fibroblast growth factor receptor substrate 3 (Gene Name=FRS3)

[Back to BioLiP]