Structure of PDB 2ypb Chain A Binding Site BS01

Receptor Information
>2ypb Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILR
LAMKYINFLAKLLNDQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypb Structural Basis for Lmo2-Driven Recruitment of the Scl:E47bHLH Heterodimer to Hematopoietic-Specific Transcriptional Targets.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		R189 N193 R197 N204 S224 K225
Binding residue
(residue number reindexed from 1)		R9 N13 R17 N24 S44 K45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046983 protein dimerization activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ypb, PDBe:2ypb, PDBj:2ypb
PDBsum2ypb
PubMed23831025
UniProtP17542|TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 (Gene Name=TAL1)

[Back to BioLiP]