Structure of PDB 2yle Chain A Binding Site BS01

Receptor Information
>2yle Chain A (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSRDALSLEEILRLYNQPINEEQAWAVCYQCCGSLRAAARRRQPRHRVR
SAAQIRVWRDGAVTLAPAKLGYSQCMETEVIESLGIIIYKALDYGLKENE
ERELSPPLEQLIDHMANTVEEKRKISAIRSYRDVMKLCAAHLPTESDAPN
HYQAVCRALFAETMELHTFLT
Ligand information
>2yle Chain B (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLYKIKPRHDSGIKAKISMKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yle Molecular Basis of Actin Nucleation Factor Cooperativity: Crystal Structure of the Spir-1 Kinase Non-Catalytic C-Lobe Domain (Kind)Formin-2 Formin Spir Interaction Motif (Fsi) Complex.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		P52 Y134 K135 D138 L141 E143 N144 E145 E146 R147 E148 E154 D158 A161 T163
Binding residue
(residue number reindexed from 1)		P19 Y89 K90 D93 L96 E98 N99 E100 E101 R102 E103 E109 D113 A116 T118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016192 vesicle-mediated transport
GO:0045010 actin nucleation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2yle, PDBe:2yle, PDBj:2yle
PDBsum2yle
PubMed21705804
UniProtQ08AE8|SPIR1_HUMAN Protein spire homolog 1 (Gene Name=SPIRE1)

[Back to BioLiP]