Structure of PDB 2ykt Chain A Binding Site BS01

Receptor Information
>2ykt Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYF
DALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLT
QLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKPQKYSD
KELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSA
AYHSKGKELLAQKLPLWQQACADPS
Ligand information
>2ykt Chain B (length=12) Species: 544404 (Escherichia coli O157:H7 str. TW14359) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GTVQNPYADVKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ykt Structural Basis for Complex Formation between Human Irsp53 and the Translocated Intimin Receptor Tir of Enterohemorrhagic E. Coli.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		K108 L111 D112 Y115 E189 R191 R192 R193 C195
Binding residue
(residue number reindexed from 1)		K105 L108 D109 Y112 E180 R182 R183 R184 C186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008093 cytoskeletal anchor activity
Biological Process
GO:0007009 plasma membrane organization
GO:0032956 regulation of actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ykt, PDBe:2ykt, PDBj:2ykt
PDBsum2ykt
PubMed21893288
UniProtQ9UQB8|BAIP2_HUMAN BAR/IMD domain-containing adapter protein 2 (Gene Name=BAIAP2)

[Back to BioLiP]