Structure of PDB 2yka Chain A Binding Site BS01

Receptor Information
>2yka Chain A (length=124) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDA
DIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVP
LDGRPMDIQLVASQIDLEHHHHHH
Ligand information
>2yka Chain B (length=23) Species: 10381 (Saimiriine gammaherpesvirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPLGSSCKTSWADRVREAAAQRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yka Competitive and Cooperative Interactions Mediate RNA Transfer from Herpesvirus Saimiri Orf57 to the Mammalian Export Adaptor Alyref.
ResolutionN/A
Binding residue
(original residue number in PDB)		D83 V86 D90 L94 E97 Y135 G137 V138 P139 L140 M145
Binding residue
(residue number reindexed from 1)		D44 V47 D51 L55 E58 Y96 G98 V99 P100 L101 M106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2yka, PDBe:2yka, PDBj:2yka
PDBsum2yka
PubMed24550725
UniProtQ9JJW6|ALRF2_MOUSE Aly/REF export factor 2 (Gene Name=Alyref2)

[Back to BioLiP]