Structure of PDB 2yj1 Chain A Binding Site BS01

Receptor Information
>2yj1 Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRY
RRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALC
VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAA
E
Ligand information
>2yj1 Chain B (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WAREIGAKLRRMADDLNAQYE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yj1 Structural Basis of Bcl-Xl Recognition by a Bh3-Mimetic Alpha-Beta-Peptide Generated Via Sequence-Based Design
Resolution2.24 Å
Binding residue
(original residue number in PDB)		E96 F97 R100 Y101 L108 Q111 V126 E129 L130 N136 G138 R139 L194 Y195 A200 A201 E202
Binding residue
(residue number reindexed from 1)		E45 F46 R49 Y50 L57 Q60 V75 E78 L79 N85 G87 R88 L143 Y144 A149 A150 E151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2yj1, PDBe:2yj1, PDBj:2yj1
PDBsum2yj1
PubMed21744457
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]