Structure of PDB 2yh1 Chain A Binding Site BS01

Receptor Information
>2yh1 Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNF
AFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVP
GVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATG
LSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yh1 Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
ResolutionN/A
Binding residue
(original residue number in PDB)		R150 Y152 K195 N196 F197 F199 K225 R227 R228 P229 H230 D231 K260 F262 G264 G265 N289 V291 S294 T296 K300 Y302 F304 L331
Binding residue
(residue number reindexed from 1)		R3 Y5 K48 N49 F50 F52 K78 R80 R81 P82 H83 D84 K113 F115 G117 G118 N142 V144 S147 T149 K153 Y155 F157 L184
Binding affinityPDBbind-CN: Kd=1.32uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2yh1, PDBe:2yh1, PDBj:2yh1
PDBsum2yh1
PubMed21753750
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]