Structure of PDB 2ych Chain A Binding Site BS01

Receptor Information

>2ych Chain A (length=336) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRVEALGLEIGASALKLVEVSGNPPALKALASRPTPPGLLMEGMVAEPAA
LAQEIKELLLEARTRKRYVVTALSNLAVILRPIQVPKMPLKEMEEAVRWE
AERYIPFPIEVVLDFAPLTPLSEVQEGEQVQVMVAAARQEAVAGVLEALR
GAGLVPVVLDVKPFAGLYPLEARLAEEPDRVFLVLDIGAESTSLVLLRGD
KPLAVRVLTLSGKDFTEAIARSFNLDLLAAEEVKRTYGRIYDAIRPVLVE
LTQELRRSLEFFRIQLSPEVGYLLGGGSKLRGLASLLTDTLGVNLEPVNP
WEAVAVDPKRFESEQLQEIGPEFAVALGLALRGVEP

Ligand information

>2ych Chain B (length=8) Species: 262724 (Thermus thermophilus HB27) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MIRLNLLP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ych Structure of the Pilm-Piln Inner Membrane Type Iv Pilus Biogenesis Complex from Thermus Thermophilus.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	V123 D125 F126 V168 V169 L170 L178 Y179 E182 D211 R371 E374
Binding residue (residue number reindexed from 1)	V112 D114 F115 V157 V158 L159 L167 Y168 E171 D200 R332 E335

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:2ych, PDBe:2ych, PDBj:2ych
PDBsum	2ych
PubMed	21596754
UniProt	Q72IW8

[Back to BioLiP]