Structure of PDB 2y8w Chain A Binding Site BS01

Receptor Information
>2y8w Chain A (length=215) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTGAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLW
RLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLR
FRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWV
QILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGV
GPGKALGLGLLSVAP
Ligand information
>2y8w Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uccccacgcguguggggaug
.<<<<<<....>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y8w An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R17 Y23 E24 H26 R27 T28 S30 K31 S34 E38 R43 K105 R106 A108 K112 R113 E121 R128 R129 R158 K160 D161 K167 L168 L169 Q170 V171 K200
Binding residue
(residue number reindexed from 1)		R21 Y27 E28 H30 R31 T32 S34 K35 S38 E42 R47 K109 R110 A112 K116 R117 E125 R132 R133 R162 K164 D165 K171 L172 L173 Q174 V175 K204
Binding affinityPDBbind-CN: Kd=2.6nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y8w, PDBe:2y8w, PDBj:2y8w
PDBsum2y8w
PubMed21572442
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]