Structure of PDB 2y0n Chain A Binding Site BS01

Receptor Information
>2y0n Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAIN
AAFSAAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKVTSSEFD
QPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRFLA
EYHDDFFPESAYVAA
Ligand information
>2y0n Chain H (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VTSFFPITPFLPVVAFGRPLPKLAPQNFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y0n Structural Basis for Mof and Msl3 Recruitment Into the Dosage Compensation Complex by Msl1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N250 L253 E256 N476 L480
Binding residue
(residue number reindexed from 1)		N59 L62 E65 N134 L138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2y0n, PDBe:2y0n, PDBj:2y0n
PDBsum2y0n
PubMed21217699
UniProtQ8N5Y2|MS3L1_HUMAN MSL complex subunit 3 (Gene Name=MSL3)

[Back to BioLiP]