Structure of PDB 2xyi Chain A Binding Site BS01

Receptor Information
>2xyi Chain A (length=379) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQ
DGKDYSVHRLILGTHTSDEQNHLLIASVQLPKIEIEIKINHEGEVNRARY
MPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYG
LSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED
VAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFN
PYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETI
LASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSW
NPNEPWIICSVSEDNIMQVWQMAENVYND
Ligand information
>2xyi Chain B (length=14) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKPAIRRLARRGGV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xyi Chromatin-Modifying Complex Component Nurf55/P55 Associates with Histones H3, H4 and Polycomb Repressive Complex 2 Subunit Su(Z)12 Through Partially Overlapping Binding Sites.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		I27 W28 N31 L35 D362 D365 G366 L370 I373
Binding residue
(residue number reindexed from 1)		I17 W18 N21 L25 D326 D329 G330 L334 I337
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0005515 protein binding
GO:0031491 nucleosome binding
GO:0042393 histone binding
GO:0042803 protein homodimerization activity
GO:0042826 histone deacetylase binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006335 DNA replication-dependent chromatin assembly
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0007307 eggshell chorion gene amplification
GO:0007346 regulation of mitotic cell cycle
GO:0007379 segment specification
GO:0031507 heterochromatin formation
GO:0034728 nucleosome organization
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0140718 facultative heterochromatin formation
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005700 polytene chromosome
GO:0016581 NuRD complex
GO:0016589 NURF complex
GO:0031523 Myb complex
GO:0033186 CAF-1 complex
GO:0035097 histone methyltransferase complex
GO:0035098 ESC/E(Z) complex
GO:0070822 Sin3-type complex
GO:0090575 RNA polymerase II transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xyi, PDBe:2xyi, PDBj:2xyi
PDBsum2xyi
PubMed21550984
UniProtQ24572|CAF1_DROME Chromatin assembly factor 1 p55 subunit (Gene Name=Caf1-55)

[Back to BioLiP]