Structure of PDB 2xs5 Chain A Binding Site BS01

Receptor Information
>2xs5 Chain A (length=82) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGF
VSFYNDVDVQKIVESQINFHGKKLKLGPAIRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xs5 Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
Resolution1.6 Å
Binding residue
(original residue number in PDB)		F43 K70 I72 T73 S79 K80 Y82 F84 K109 P112 A113 I114 R115 K116
Binding residue
(residue number reindexed from 1)		F9 K36 I38 T39 S45 K46 Y48 F50 K75 P78 A79 I80 R81 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding

View graph for
Molecular Function
External links
PDB RCSB:2xs5, PDBe:2xs5, PDBj:2xs5
PDBsum2xs5
PubMed22021443
UniProtQ64368|DAZL_MOUSE Deleted in azoospermia-like (Gene Name=Dazl)

[Back to BioLiP]