Structure of PDB 2xs3 Chain A Binding Site BS01

Receptor Information
>2xs3 Chain A (length=166) Species: 28112 (Tannerella forsythia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVLQGSKWNKTTLKYYIYNSSSHLTTTERENAIRSAFALWSDKSTLSFIQ
VYNPNQADIKIKWEKGNHGDGYPFDGNTGILAHAFYPPPAGGNYAGHLHF
DDDENWSINGSGIDLITVAAHEIGHLLGIEHSNVSSALMYPYYTGIKRQL
DNDDCLAVWDLYGYPF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xs3 The Structure of the Catalytic Domain of Tannerella Forsythia Karilysin Reveals It is a Bacterial Xenologue of Animal Matrix Metalloproteinases.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T112 H155 E156 H159 H165 P175 Y176 Y177
Binding residue
(residue number reindexed from 1)		T78 H121 E122 H125 H131 P141 Y142 Y143
Enzymatic activity
Catalytic site (original residue number in PDB) H155 E156 H159 H165
Catalytic site (residue number reindexed from 1) H121 E122 H125 H131
Enzyme Commision number 3.4.24.-
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xs3, PDBe:2xs3, PDBj:2xs3
PDBsum2xs3
PubMed21166898
UniProtD0EM77|KLY_TANFA Karilysin (Gene Name=kly)

[Back to BioLiP]