Structure of PDB 2xs2 Chain A Binding Site BS01

Receptor Information
>2xs2 Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKG
YGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xs2 Kinked beta-strands mediate high-affinity recognition of mRNA targets by the germ-cell regulator DAZL.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		F43 K70 I72 Y82 F84 K109 P112 A113 I114 R115 K116 H123
Binding residue
(residue number reindexed from 1)		F12 K39 I41 Y51 F53 K78 P81 A82 I83 R84 K85 H87
Binding affinityPDBbind-CN: Kd=38.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding

View graph for
Molecular Function
External links
PDB RCSB:2xs2, PDBe:2xs2, PDBj:2xs2
PDBsum2xs2
PubMed22021443
UniProtQ64368|DAZL_MOUSE Deleted in azoospermia-like (Gene Name=Dazl)

[Back to BioLiP]