Structure of PDB 2xqq Chain A Binding Site BS01

Receptor Information
>2xqq Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNP
TWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xqq Directed Evolution Reveals the Binding Motif Preference of the Lc8/Dynll Hub Protein and Predicts Large Numbers of Novel Binders in the Human Proteome
Resolution1.31 Å
Binding residue
(original residue number in PDB)		K9 N61 F62 G63 S64 Y65 V66 T67 H68 F73 Y75 Y77
Binding residue
(residue number reindexed from 1)		K7 N59 F60 G61 S62 Y63 V64 T65 H66 F71 Y73 Y75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0007017 microtubule-based process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030286 dynein complex
GO:0031475 myosin V complex
GO:0097542 ciliary tip
GO:0097731 9+0 non-motile cilium
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xqq, PDBe:2xqq, PDBj:2xqq
PDBsum2xqq
PubMed21533121
UniProtQ96FJ2|DYL2_HUMAN Dynein light chain 2, cytoplasmic (Gene Name=DYNLL2)

[Back to BioLiP]