Structure of PDB 2xpx Chain A Binding Site BS01

Receptor Information
>2xpx Chain A (length=153) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHV
LLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRPSLGRALAW
MAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLI
EDN
Ligand information
>2xpx Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STMGQVGRQLAIIGDDINRRYDS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xpx Structural Basis for Apoptosis Inhibition by Epstein-Barr Virus Bhrf1.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		I57 N61 T64 F65 R71 F72 H75 D82 I90 S97 G99 R100 L102 A103 W107
Binding residue
(residue number reindexed from 1)		I55 N59 T62 F63 R69 F70 H73 D80 I88 S93 G95 R96 L98 A99 W103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2xpx, PDBe:2xpx, PDBj:2xpx
PDBsum2xpx
PubMed21203485
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]