Structure of PDB 2xpp Chain A Binding Site BS01

Receptor Information
>2xpp Chain A (length=137) Species: 6035 (Encephalitozoon cuniculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKAL
QESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVT
SGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFK
Ligand information
>2xpp Chain B (length=24) Species: 6035 (Encephalitozoon cuniculi) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IDYGDRDSLFFEIFGTGEEYRYVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xpp The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
Resolution1.74 Å
Binding residue
(original residue number in PDB)		E124 P125 K151 K161 I162 F165 T188 V191
Binding residue
(residue number reindexed from 1)		E68 P69 K95 K105 I106 F109 T132 V135
Enzymatic activity
Enzyme Commision number ?
External links