Structure of PDB 2xpo Chain A Binding Site BS01

Receptor Information
>2xpo Chain A (length=139) Species: 6035 (Encephalitozoon cuniculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMS
KALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEH
LVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVF
Ligand information
>2xpo Chain B (length=15) Species: 6035 (Encephalitozoon cuniculi) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FFEIFGTGEEYRYVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xpo The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E124 P125 G160 K161 I162 Y164 F165 T188
Binding residue
(residue number reindexed from 1)		E71 P72 G107 K108 I109 Y111 F112 T135
Enzymatic activity
Enzyme Commision number ?
External links