Structure of PDB 2xma Chain A Binding Site BS01

Receptor Information
>2xma Chain A (length=139) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMTYVILPLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDIL
RDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFV
AYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xma DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		C27 K29 Y30 R31 H32 H67 H69 V84 K85 K88 G89 A90 A92 R93 F96 K105 W107 G108 N110 L111 W112 N113 P114 S115 Y116
Binding residue
(residue number reindexed from 1)		C30 K32 Y33 R34 H35 H70 H72 V87 K88 K91 G92 A93 A95 R96 F99 K108 W110 G111 N113 L114 W115 N116 P117 S118 Y119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xma, PDBe:2xma, PDBj:2xma
PDBsum2xma
PubMed20890269
UniProtQ7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)

[Back to BioLiP]