Structure of PDB 2xlj Chain A Binding Site BS01

Receptor Information
>2xlj Chain A (length=178) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLDE
SRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQ
VSRVQAKSNPERLRRRLMRRHDEEEARKRLDLPFVTLRSQSTGQHFRLFI
RHGPLQVTAEEGGFTCYGLSKGGFVPWF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xlj Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R102 Q104 N108 R111 R114 R115 R118 R119 H120 Q149 Q153 F155 Y176
Binding residue
(residue number reindexed from 1)		R103 Q105 N109 R112 R115 R116 R119 R120 H121 Q140 Q144 F146 Y167
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xlj, PDBe:2xlj, PDBj:2xlj
PDBsum2xlj
PubMed20829488
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]