Structure of PDB 2xjz Chain A Binding Site BS01

Receptor Information
>2xjz Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCR
RDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCV
GDRYLLINSDIVCEQDIYEWTKING
Ligand information
>2xjz Chain I (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVMVVGEPTLMGGEFGDEDERLITRLENT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D32 R33 Y34 F35 L36 K37 I39 R62 R63 L64 Y65 Y66 K67 Y77 Q83 G85 I94 R95 A96 E98 M99 T100 M101 R102 K104 F122 C123 G125 D126 R127 Y128 L129
Binding residue
(residue number reindexed from 1)		D8 R9 Y10 F11 L12 K13 I15 R38 R39 L40 Y41 Y42 K43 Y53 Q59 G61 I70 R71 A72 E74 M75 T76 M77 R78 K80 F98 C99 G101 D102 R103 Y104 L105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum2xjz
PubMed21076045
UniProtP25791|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)

[Back to BioLiP]