Structure of PDB 2xhs Chain A Binding Site BS01

Receptor Information

>2xhs Chain A (length=243) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHMLEDPLRVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFEL
MCKVLDQNLFSQVDWARNTVFFKDLKVDDQMKLLQHSWSDMLVLDHLHHR
IHNGLPDETQLNNGQVFNLMSLGLLGVPQLGDYFNELQNKLQDLKFDMGD
YVCMKFLILLNPSVRGIVNRKTVSEGHDNVQAALLDYTLTCYPSVNDKFR
GLVNILPEIHAMAVRGEDHLYTKHCAGSAPTQTLLMEMLHAKR

Ligand information

>2xhs Chain B (length=9) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

STLRALLTN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2xhs Crystal Structure of Fushi Tarazu Factor 1 Ligand Binding Domain/Fushi Tarazu Peptide Complex Identifies New Class of Nuclear Receptors.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	F842 R849 Q862 M863 E1019 R1025
Binding residue (residue number reindexed from 1)	F60 R67 Q80 M81 E237 R243

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:2xhs, PDBe:2xhs, PDBj:2xhs
PDBsum	2xhs
PubMed	21775434
UniProt	P33244\|FTZF1_DROME Nuclear hormone receptor FTZ-F1 (Gene Name=ftz-f1)

[Back to BioLiP]