Structure of PDB 2xfx Chain A Binding Site BS01

Receptor Information
>2xfx Chain A (length=277) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAVSRPGLREPLFITVGYVDDTQFVRFDSDARDPRTEPRQP
WMEKEGPEYWDRETQISKENALWYREALNNLRGYYNQSEAGSHTLQEMYG
CDVGSDGRLRRGYEQYGYDGRDYLALNEDLRSWTAADTAAQISKRKMEAA
GAAERFRNYLEGTCVEWLRRYLENGKDTLLRADPPKAHVTRHPSSEHEVT
LRCWALGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGNFQKWAALVVP
SGEEQRYTCRVQHEGLQEPLTLRWEPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xfx Mhc Class I Bound to an Immunodominant Theileria Parva Epitope Demonstrates Unconventional Presentation to T Cell Receptors.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 R62 E63 N70 W73 A77 N80 Y84 E97 Y99 Y116 S143 K146 M147 A150 R155 F156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 E63 N70 W73 A77 N80 Y84 E97 Y99 Y116 S143 K146 M147 A150 R155 F156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links