Structure of PDB 2xcb Chain A Binding Site BS01

Receptor Information
>2xcb Chain A (length=133) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGL
GACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESG
FYSARALAAAQPAHEALAARAGAMLEAVTARKD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xcb Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y40 A41 F44 Y47 A78 R105 H109
Binding residue
(residue number reindexed from 1)		Y14 A15 F18 Y21 A52 R79 H83
Enzymatic activity
Enzyme Commision number ?
External links