Structure of PDB 2xa0 Chain A Binding Site BS01

Receptor Information
>2xa0 Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNREIVMKYIHYKLSQRGYEWDVVHLTLRQAGDDFSRRYRRDFAEMSSQL
HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPL
VDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSM
Ligand information
>2xa0 Chain C (length=26) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKLSECLRRIGDELDSNMELQRMIAD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xa0 Evidence that Inhibition of Bax Activation by Bcl- 2 Involves its Tight and Preferential Interaction with the Bh3 Domain of Bax.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F104 R107 Y108 R110 F112 Q118 E136 L137 R139 D140 N143 W144 G145 R146 F153 E200 L201 P204 S205
Binding residue
(residue number reindexed from 1)		F35 R38 Y39 R41 F43 Q49 E67 L68 R70 D71 N74 W75 G76 R77 F84 E131 L132 P135 S136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xa0, PDBe:2xa0, PDBj:2xa0
PDBsum2xa0
PubMed21060336
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]