Structure of PDB 2x7k Chain A Binding Site BS01

Receptor Information

>2x7k Chain A (length=164) Species: 9606 (Homo sapiens)

AIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTK
FHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMAN
AGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDR
PVDDVKIIKAYPSG

Ligand information

>2x7k Chain B (length=11) Species: 29910 (Tolypocladium inflatum)

ALLVTAGLVLA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2x7k The Crystal Structure of Ppil1 Bound to Cyclosporine a Suggests a Binding Mode for a Linear Epitope of the Skip Protein.
• Resolution: 1.15 Å
• Binding residue (original residue number in PDB): R55 F60 Q63 G71 A101 N102 Q111 F113 W121 H126
• Binding residue (residue number reindexed from 1): R53 F58 Q61 G69 A99 N100 Q109 F111 W119 H124

Enzymatic activity

• Catalytic site (original residue number in PDB): R55 F60 Q63 N102 F113 L122 H126
• Catalytic site (residue number reindexed from 1): R53 F58 Q61 N100 F111 L120 H124
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

Molecular Function

• GO:0003755 peptidyl-prolyl cis-trans isomerase activity
• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0097718 disordered domain specific binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000413 protein peptidyl-prolyl isomerization
• GO:0006397 mRNA processing
• GO:0006457 protein folding
• GO:0008380 RNA splicing
• GO:1990403 embryonic brain development

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:2x7k, PDBe:2x7k, PDBj:2x7k
• PDBsum: 2x7k
• PubMed: 20368803
• UniProt: Q9Y3C6|PPIL1_HUMAN Peptidyl-prolyl cis-trans isomerase-like 1 (Gene Name=PPIL1)