Structure of PDB 2x6v Chain A Binding Site BS01

Receptor Information

>2x6v Chain A (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYIL
LMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQL
VSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADTAFCTHVFPETAF
IAVTSYQNHKITQLKIENNPFAKGFRG

Ligand information

>2x6v Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctcacacctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2x6v Structural Basis of Tbx5-DNA Recognition: The T-Box Domain in its DNA-Bound and -Unbound Form.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	S175 T215 P231 F232 K234 G235
Binding residue (residue number reindexed from 1)	S123 T154 P170 F171 K173 G174
Binding affinity	PDBbind-CN: Kd=109nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2x6v, PDBe:2x6v, PDBj:2x6v
PDBsum	2x6v
PubMed	20450920
UniProt	Q99593\|TBX5_HUMAN T-box transcription factor TBX5 (Gene Name=TBX5)

[Back to BioLiP]