Structure of PDB 2x6m Chain A Binding Site BS01

Receptor Information
>2x6m Chain A (length=126) Species: 9838 (Camelus dromedarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQLVESGGGSVQAGGSLRLSCAASGIDSSSYCMGWFRQRPGKEREGVARI
NGLGGVKTAYADSVKDRFTISRDNAENTVYLQMNSLKPEDTAIYYCAAKF
SPGYCGGSWSNFGYWGQGTQVTVSSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x6m Structure and Properties of a Complex of Alpha-Synuclein and a Single-Domain Camelid Antibody.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		R50 N52 G56 V57 K58 T59 Y105 G108
Binding residue
(residue number reindexed from 1)		R49 N51 G55 V56 K57 T58 Y104 G107
External links