Structure of PDB 2x4y Chain A Binding Site BS01

Receptor Information
>2x4y Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDSPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVL
KLGEQMTQEAREHLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLE
GRKSNIRKSVQIAYHRALQHRSKVQGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x4y Molecular Basis of Histone H3K36Me3 Recognition by the Pwwp Domain of Brpf1.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y1096 Y1099 R1110 E1111 G1112 M1113 F1114 P1119 P1121 V1122 L1130 F1147 K1151 R1152 T1153 W1154
Binding residue
(residue number reindexed from 1)		Y18 Y21 R32 E33 G34 M35 F36 P41 P43 V44 L52 F69 K73 R74 T75 W76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2x4y, PDBe:2x4y, PDBj:2x4y
PDBsum2x4y
PubMed20400950
UniProtP55201|BRPF1_HUMAN Peregrin (Gene Name=BRPF1)

[Back to BioLiP]