Structure of PDB 2x1f Chain A Binding Site BS01

Receptor Information
>2x1f Chain A (length=94) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIE
FRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISGVSLEHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x1f Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y21 G92 E105 H106 H109
Binding residue
(residue number reindexed from 1)		Y6 G77 E90 H91 H94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2x1f, PDBe:2x1f, PDBj:2x1f
PDBsum2x1f
PubMed20097654
UniProtP25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 (Gene Name=RNA15)

[Back to BioLiP]