Structure of PDB 2x1a Chain A Binding Site BS01

Receptor Information
>2x1a Chain A (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFI
EFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x1a Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		S24 I25 P26 Y27 G60 R87
Binding residue
(residue number reindexed from 1)		S10 I11 P12 Y13 G46 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:2x1a, PDBe:2x1a, PDBj:2x1a
PDBsum2x1a
PubMed20097654
UniProtP25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 (Gene Name=RNA15)

[Back to BioLiP]